Westlakevillagefamilyservices.com
Visit westlakevillagefamilyservices.comAccording to Whois record of Westlakevillagefamilyservices.com, public access to Westlakevillagefamilyservices ownership data is restricted due to privacy matters.
The current Westlakevillagefamilyservices.com owner and other personalities/entities that used to own this domain in the past are listed below.
If you would like to share more "whois" details on Westlakevillagefamilyservices with us, please contact us!
Westlakevillagefamilyservices.com whois history
General
Registration Private Domains By Proxy, LLC Owner since November 28, 2019 |
||
---|---|---|
7 months left Expires on May 28, 2025 |
15 years old Created on March 29, 2009 |
Registrar and Status
Registar | GODADDY.COM, LLC |
Status |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
Owner | Registrar | Status |
---|---|---|
Registration Private Domains By Proxy, LLC November 28, 2019 |
GoDaddy.com, LLC |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
|
If you are Westlakevillagefamilyservices owner and would like to increase privacy protection level for your data - please, deal with GoDaddy.com LLC which is your site’s registrar.
Whois history of Westlakevillagefamilyservices.com is provided using publicly open domain data.