Tampaflcriminaldefenselawyers.com
Visit tampaflcriminaldefenselawyers.comAccording to Whois record of Tampaflcriminaldefenselawyers.com, public access to Tampaflcriminaldefenselawyers ownership data is restricted due to privacy matters.
Earlier, Tampa Fl Criminal Defense Lawyers owners included Law Offices of Timothy Hessinger in 2019, ******** ******** (see Notes section below on how to view unmasked data) of Law Offices of Timothy Hessinger in 2018 and Timothy Hessinger of Law Offices of Timothy Hessinger in 2016.
The current Tampaflcriminaldefenselawyers.com owner and other personalities/entities that used to own this domain in the past are listed below.
If you would like to share more "whois" details on Tampaflcriminaldefenselawyers with us, please contact us!
Tampaflcriminaldefenselawyers.com whois history
General
|
Registration Private Domains By Proxy, LLC Owner since July 21, 2022 |
||
|---|---|---|
|
6 months ago Expired on November 08, 2023 |
13 years old Created on November 08, 2010 |
|
Registrar and Status
| Registar | GODADDY.COM, LLC |
| Status |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
| Owner | Registrar | Status |
|---|---|---|
|
Registration Private Domains By Proxy, LLC July 21, 2022 |
GoDaddy.com, LLC |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
 |
||
|
Law Offices of Timothy Hessinger December 06, 2019 |
GoDaddy.com, LLC |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
|
|
||
|
******** ******** (see Notes section below on how to view unmasked data) Law Offices of Timothy Hessinger May 19, 2018 |
GoDaddy.com, LLC |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
|
|
||
|
Timothy Hessinger Law Offices of Timothy Hessinger December 30, 2016 |
GODADDY.COM, LLC |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
|
|
||
If you are Tampaflcriminaldefenselawyers owner and would like to increase privacy protection level for your data - please, deal with GoDaddy.com LLC which is your site’s registrar.
Whois history of Tampaflcriminaldefenselawyers.com is provided using publicly open domain data.