Speakenglishwithtiffaniacademy.com
Visit speakenglishwithtiffaniacademy.comAccording to "Whois Speakenglishwithtiffaniacademy.com", Speakenglishwithtiffaniacademy is owned by REDACTED FOR PRIVACY of Privacy service provided by Withheld for Privacy ehf since 2022. Speakenglishwithtiffaniacademy was registered with NameCheap Inc. on December 04, 2018. REDACTED FOR PRIVACY resides in Reykjavik, Iceland and their email is 1d06a4ade0bc40e8bded3ea51613f647.protect@withheldforprivacy.com.
The current Speakenglishwithtiffaniacademy.com owner and other personalities/entities that used to own this domain in the past are listed below.
If you would like to share more "whois" details on Speakenglishwithtiffaniacademy with us, please contact us!
Speakenglishwithtiffaniacademy.com whois history
General
Redacted for Privacy Privacy service provided by Withheld for Privacy ehf Owner since August 30, 2022 |
||
---|---|---|
14 days left Expires on December 04, 2024 |
5 years old Created on December 04, 2018 |
Registrar and Status
Registar | NAMECHEAP, INC. |
Sponsor | NAMECHEAP INC |
Status |
clientTransferProhibited |
Owner | Registrar | Status |
---|---|---|
Redacted for Privacy Privacy service provided by Withheld for Privacy ehf August 30, 2022 |
NameCheap, Inc. |
clientTransferProhibited |
|
||
WhoisGuard Protected WhoisGuard, Inc. September 24, 2019 |
NameCheap, Inc. |
clientTransferProhibited |
|
If you are Speakenglishwithtiffaniacademy owner and would like to increase privacy protection level for your data - please, deal with NameCheap Inc. which is your site’s registrar.
Whois history of Speakenglishwithtiffaniacademy.com is provided using publicly open domain data.