Pleasantviewfamilyhealthcare.com
Visit pleasantviewfamilyhealthcare.comAccording to "Whois Pleasantviewfamilyhealthcare.com", Pleasantviewfamilyhealthcare is owned by Domain Administrator of HCA - Information Technology & Services Inc. since 2021. Pleasantviewfamilyhealthcare was registered with MarkMonitor Inc. on August 04, 2010. Domain Administrator resides in Nashville, USA and their email is ehc.hostmaster@ehc.com.
The current Pleasantviewfamilyhealthcare.com owner and other personalities/entities that used to own this domain in the past are listed below.
If you would like to share more "whois" details on Pleasantviewfamilyhealthcare with us, please contact us!
Pleasantviewfamilyhealthcare.com whois history
General
|
Domain Administrator HCA - Information Technology & Services, Inc. Owner since December 23, 2021 |
||
|---|---|---|
|
8 months left Expires on August 04, 2025 |
14 years old Created on August 04, 2010 |
|
Registrar and Status
| Registar | MarkMonitor Inc. |
| Status |
clientDeleteProhibited clientTransferProhibited clientUpdateProhibited |
| Owner | Registrar | Status |
|---|---|---|
|
Domain Administrator HCA - Information Technology & Services, Inc. December 23, 2021 |
MarkMonitor Inc. |
clientDeleteProhibited clientTransferProhibited clientUpdateProhibited |
 |
||
|
PERFECT PRIVACY, LLC December 21, 2020 |
Network Solutions, LLC |
clientTransferProhibited |
|
|
||
If you are Pleasantviewfamilyhealthcare owner and would like to increase privacy protection level for your data - please, deal with MarkMonitor Inc. which is your site’s registrar.
Whois history of Pleasantviewfamilyhealthcare.com is provided using publicly open domain data.