Pheaseyparkfarmchildrenscentrenursery.co.uk
Visit pheaseyparkfarmchildrenscentrenursery.co.ukAccording to "Whois Pheaseyparkfarmchildrenscentrenursery.co.uk", Pheaseyparkfarmchildrenscentrenursery is owned by PRIMARYSITE LIMITED since 2018. Pheaseyparkfarmchildrenscentrenursery was registered with Nominet UK on March 19, 2015.
The current Pheaseyparkfarmchildrenscentrenursery.co.uk owner and other personalities/entities that used to own this domain in the past are listed below.
If you would like to share more "whois" details on Pheaseyparkfarmchildrenscentrenursery with us, please contact us!
Pheaseyparkfarmchildrenscentrenursery.co.uk whois history
General
PRIMARYSITE LIMITED Owner since February 26, 2018 |
||
---|---|---|
6 months ago Expired on March 19, 2024 |
9 years old Created on March 19, 2015 |
Registrar and Status
Registar | Nominet UK |
Sponsor | Ionos SE [Tag = 1AND1] |
Status |
Registered until expiry date. |
Owner | Registrar | Status |
---|---|---|
PRIMARYSITE LIMITED February 26, 2018 |
Nominet UK |
Registered until expiry date. |
|
If you are Pheaseyparkfarmchildrenscentrenursery owner and would like to increase privacy protection level for your data - please, deal with Nominet UK which is your site’s registrar.
Whois history of Pheaseyparkfarmchildrenscentrenursery.co.uk is provided using publicly open domain data.