Kathrynleesmithwhitelineprints.com
Visit kathrynleesmithwhitelineprints.comAccording to Whois record of Kathrynleesmithwhitelineprints.com, it is owned by Smith Kathryn since 2022. Kathrynleesmithwhitelineprints was registered with Network Solutions LLC on February 04, 2009. Smith Kathryn resides in PROVINCETOWN, USA and their email is ksmithart@verizon.net.
The current Kathrynleesmithwhitelineprints.com owner and other personalities/entities that used to own this domain in the past are listed below.
If you would like to share more "whois" details on Kathrynleesmithwhitelineprints with us, please contact us!
Kathrynleesmithwhitelineprints.com whois history
General
|
Smith, Kathryn Owner since February 20, 2022 |
||
|---|---|---|
|
9 months ago Expired on February 04, 2024 |
15 years old Created on February 04, 2009 |
|
Registrar and Status
| Registar | Network Solutions, LLC |
| Status |
clientTransferProhibited |
| Owner | Registrar | Status |
|---|---|---|
|
Smith, Kathryn February 20, 2022 |
Network Solutions, LLC |
clientTransferProhibited |
 |
||
|
PERFECT PRIVACY, LLC February 03, 2021 |
Network Solutions, LLC |
clientTransferProhibited |
|
|
||
If you are Kathrynleesmithwhitelineprints owner and would like to increase privacy protection level for your data - please, deal with Network Solutions LLC which is your site’s registrar.
Whois history of Kathrynleesmithwhitelineprints.com is provided using publicly open domain data.