Eniyievdenevenakliyatfirmalari.com
Visit eniyievdenevenakliyatfirmalari.comAccording to Whois record of Eniyievdenevenakliyatfirmalari.com, it is owned by REDACTED FOR PRIVACY of REDACTED FOR PRIVACY since 2019. Eniyievdenevenakliyatfirmalari was registered with Realtime Register B.V. on September 24, 2018. REDACTED FOR PRIVACY resides in REDACTED FOR PRIVACY, USA and their email is https://tieredaccess.com/contact/a2afa62a-71d5-4b8f-bc4d-f10c4842c9fe.
The current Eniyievdenevenakliyatfirmalari.com owner and other personalities/entities that used to own this domain in the past are listed below.
If you would like to share more "whois" details on Eniyievdenevenakliyatfirmalari with us, please contact us!
Eniyievdenevenakliyatfirmalari.com whois history
General
|
REDACTED FOR PRIVACY Owner since December 21, 2019 |
||
|---|---|---|
|
4 years ago Expired on September 24, 2019 |
5 years old Created on September 24, 2018 |
|
Registrar and Status
| Registar | Realtime Register B.V. |
| Sponsor | Yurdum Yayincilik ve Yazilim Ltd. |
| Status |
clientTransferProhibited ok |
| Owner | Registrar | Status |
|---|---|---|
|
REDACTED FOR PRIVACY December 21, 2019 |
Realtime Register B.V. |
clientTransferProhibited ok |
 |
||
If you are Eniyievdenevenakliyatfirmalari owner and would like to increase privacy protection level for your data - please, deal with Realtime Register B.V. which is your site’s registrar.
Whois history of Eniyievdenevenakliyatfirmalari.com is provided using publicly open domain data.