Ankaraevdenevenakliyatfirmasi.com
Visit ankaraevdenevenakliyatfirmasi.comAccording to "Whois Ankaraevdenevenakliyatfirmasi.com", Ankaraevdenevenakliyatfirmasi is owned by REDACTED FOR PRIVACY of Bireysel since 2024. Ankaraevdenevenakliyatfirmasi was registered with ODTU Gelistirme Vakfi Bilgi Teknolojileri Sanayi Ve Ticaret Anonim Sirketi on October 19, 2023. REDACTED FOR PRIVACY resides in REDACTED FOR PRIVACY, REDACTED FOR PRIVACY and their email is REDACTED FOR PRIVACY.
Earlier, Ankara Evden Eve Nakliyat Firmasi owners included Yksel ILGEN of Yksel ILGEN in 2019.
The current Ankaraevdenevenakliyatfirmasi.com owner and other personalities/entities that used to own this domain in the past are listed below.
If you would like to share more "whois" details on Ankaraevdenevenakliyatfirmasi with us, please contact us!
Ankaraevdenevenakliyatfirmasi.com whois history
General
|
REDACTED FOR PRIVACY Bireysel Owner since June 26, 2024 |
||
|---|---|---|
|
13 days left Expires on October 19, 2024 |
11 months old Created on October 19, 2023 |
|
Registrar and Status
| Registar | ODTU Gelistirme Vakfi Bilgi Teknolojileri Sanayi Ve Ticaret Anonim Sirketi |
| Sponsor | Yksel ILGEN |
| Status |
clientTransferProhibited |
| Owner | Registrar | Status |
|---|---|---|
|
REDACTED FOR PRIVACY Bireysel June 26, 2024 |
ODTU Gelistirme Vakfi Bilgi Teknolojileri Sanayi Ve Ticaret Anonim Sirketi |
clientTransferProhibited |
 |
||
|
Yksel ILGEN December 05, 2019 |
Atak Domain Hosting Internet ve Bilgi Teknolojileri Limited Sirketi d/b/a Atak Teknoloji |
clientTransferProhibited |
|
|
||
If you are Ankaraevdenevenakliyatfirmasi owner and would like to increase privacy protection level for your data - please, deal with ODTU Gelistirme Vakfi Bilgi Teknolojileri Sanayi Ve Ticaret Anonim Sirketi which is your site’s registrar.
Whois history of Ankaraevdenevenakliyatfirmasi.com is provided using publicly open domain data.